PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 722aa    MW: 80962.5 Da    PI: 7.0055
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874038.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.13.9e-1113517203374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL++cA+a +s d+  a++lL++++e++s +gd++qR+a+yf+ +L+arl +  +    +++p   ++ + +e l a++lf  ++P+ ++s++ 
  XP_015874038.1 351 TLLTQCAQAAASYDQITATKLLKQIREHSSVEGDATQRVAHYFASGLEARLEGIRTP---SFTPHVRNHVSPAEILEAYHLFLTACPFKRMSNFF 442
                     69***************************************************2222...23344444455899********************* PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN++Il+ +++++r+HiiDf+i  G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   + ++e   +rL++++++++vp+ef++ +a+++e ++
  XP_015874038.1 443 ANRTILKLAQKATRIHIIDFGILFGFQWPCLIQHLSKRPGGPPKLRITGIELPQPGfrPSATVEGAVHRLKNYCKRFNVPVEFKI-IAQKWEIIQ 536
                     *******************************************************999999***********************9.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     +e+L+++++E +aVn+  +l++++de+v  +++rd+vLkl++s++P+v++    +   ns+ Fl+rf eal +y +lfd+l+a++pre+++r++ 
  XP_015874038.1 537 VEDLNIDRDEFTAVNCLSRLKHIPDETVMPNNPRDTVLKLIRSMNPDVFITGVINGTFNSPFFLTRFKEALFHYFTLFDMLDASVPRENKARMNF 631
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     Er++ g+ei+nv+ cegaer+ r et+++W++r+++aGFk+++ ++++++++k++++  + + + v e+ ++l++gWk+r  +++++W+
  XP_015874038.1 632 ERAIYGKEIMNVIGCEGAERIVRPETYKQWQARITNAGFKQMTPNQDIVEKIKSMVKLGYHKNFVVAEQGQWLLQGWKGRICLALTSWK 720
                     ************************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.142323700IPR005202Transcription factor GRAS
PfamPF035141.3E-108351720IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MNGFKFNHVP VSDYSICSSS DSESVPSRPS NVPTNLLHGR ESTSTSTSTS TLISTTTSSS  60
SISEADSMDV GDSSNAMLKF INEMLMEEEL DGKLEDSLAL QVAEKSFYDV LGQKYPPSPI  120
QAPFSGSFKN VDKLVDRIPL RFGISEKDYY QSGYSSKDSI AANTSGVHDQ DGYEYSEVQT  180
SLSEPQVCTR SVPYSFSDLQ SFGNFRGGTG KSSSVIIPST KFGTIDMERN PLSMTAGHGE  240
NVVDMPEERN NLPTGSRAKR NHQLDHGGGN LEGRDNKHSA VYADGLSDLQ EMFDKVLLNH  300
GDDDESNALL GFSHVEGHRK LQHIEQAKES GKKTRSKEVQ NKEEEMVDLW TLLTQCAQAA  360
ASYDQITATK LLKQIREHSS VEGDATQRVA HYFASGLEAR LEGIRTPSFT PHVRNHVSPA  420
EILEAYHLFL TACPFKRMSN FFANRTILKL AQKATRIHII DFGILFGFQW PCLIQHLSKR  480
PGGPPKLRIT GIELPQPGFR PSATVEGAVH RLKNYCKRFN VPVEFKIIAQ KWEIIQVEDL  540
NIDRDEFTAV NCLSRLKHIP DETVMPNNPR DTVLKLIRSM NPDVFITGVI NGTFNSPFFL  600
TRFKEALFHY FTLFDMLDAS VPRENKARMN FERAIYGKEI MNVIGCEGAE RIVRPETYKQ  660
WQARITNAGF KQMTPNQDIV EKIKSMVKLG YHKNFVVAEQ GQWLLQGWKG RICLALTSWK  720
PA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-493537208375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874038.10.0PREDICTED: scarecrow-like protein 30
TrEMBLM5W7L00.0M5W7L0_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s24890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-158GRAS family protein